Antibodies

Jump to Filters
View as table Download
NLRC5 Rabbit Polyclonal Antibody
TA320044

USD 570.00

2 Weeks

Rabbit Polyclonal NOD4 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen NOD4 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human NOD4.
NLRC5 (N-term) Rabbit Polyclonal Antibody
AP31234PU-N

USD 500.00

2 Weeks

NLRC5 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated
NLRC5 Rabbit Polyclonal Antibody
TA342964

USD 539.00

5 Days

Rabbit Polyclonal Anti-NLRC5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRC5 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRC5. Synthetic peptide located within the following region: LLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKK