Rabbit Polyclonal NOD4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | NOD4 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human NOD4. |
Rabbit Polyclonal NOD4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | NOD4 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human NOD4. |
NLRC5 (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal Anti-NLRC5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLRC5 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRC5. Synthetic peptide located within the following region: LLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKK |