Antibodies

Jump to Filters
View as table Download
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA313900

USD 380.00

In Stock

Rabbit polyclonal anti-FZD2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD2.
Frizzled 2 (FZD2) Goat Polyclonal Antibody
AP22449PU-N

USD 520.00

5 Days

Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001457.1.
Frizzled 2 (FZD2) (C-term) Rabbit Polyclonal Antibody
AP51747PU-N

USD 580.00

2 Weeks

Frizzled 2 (FZD2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 533-563 amino acids from the C-terminal region of Human FZD2 / Frizzled-2
Frizzled 2 (FZD2) Rabbit Polyclonal Antibody
TA344058

USD 539.00

5 Days

Rabbit Polyclonal Anti-FZD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI