Rabbit Polyclonal Anti-HMGCS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the C terminal of human HMGCS2. Synthetic peptide located within the following region: DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE |
HMGCS2 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human HMGCS2 |
Rabbit Polyclonal Anti-HMGCS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the N terminal of human HMGCS2. Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE |
HMGCS2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HMGCS2 |
Germany
Japan
United Kingdom
China