BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Dog, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-BCAT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BCAT1 |
BCAT1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 88-115 amino acids from the Central region of human BCAT1 |
BCAT1 mouse monoclonal antibody, clone AT3C8, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BCAT1 mouse monoclonal antibody, clone AT3C8, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BCAT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG |