Antibodies

View as table Download

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Unconjugated

BCAT1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications IHC, WB
Reactivities Human, Dog, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAT1

BCAT1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 88-115 amino acids from the Central region of human BCAT1

BCAT1 mouse monoclonal antibody, clone AT3C8, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

BCAT1 mouse monoclonal antibody, clone AT3C8, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-BCAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCAT1 antibody: synthetic peptide directed towards the N terminal of human BCAT1. Synthetic peptide located within the following region: MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG