Antibodies

View as table Download

Rabbit Polyclonal Anti-RPS16 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the N terminal of human RPS16. Synthetic peptide located within the following region: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL

Rabbit Polyclonal Anti-RPS16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the middle region of human RPS16. Synthetic peptide located within the following region: LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKKFGGPGARAC

RPS16 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 44-74 amino acids from the Central region of Human RPS16.