Antibodies

Jump to Filters
View as table Download
B3GNT6 (Center) Rabbit Polyclonal Antibody
AP50330PU-N

USD 580.00

2 Weeks

B3GNT6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 152~182 amino acids from the Central region of human B3GNT6
B3GNT6 Rabbit Polyclonal Antibody
TA329578

USD 539.00

5 Days

Rabbit polyclonal anti-B3GNT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3GNT6 antibody is: synthetic peptide directed towards the C-terminal region of Human B3GNT6. Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP