ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal ALOX12 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ALOX12 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 618-650 amino acids from the C-terminal region of human ALOX12. |
ALOX12 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ALOX12 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ALOX12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ALOX12 Antibody: synthetic peptide directed towards the C terminal of human ALOX12. Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF |