Antibodies

Jump to Filters
View as table Download
SIRT6 Rabbit Polyclonal Antibody
TA301523

USD 550.00

5 Days

Rabbit Polyclonal Antibody against SIRT6

Applications Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human SIRT6 protein (within residues 250-350). [Swiss-Prot Q8N6T7]
SIRT6 Rabbit Polyclonal Antibody
TA301524

USD 550.00

5 Days

Rabbit Polyclonal Antibody against SIRT6

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human SIRT6 protein (within residues 300-355). [Swiss-Prot Q8N6T7]
SIRT6 Rabbit Polyclonal Antibody
TA330290

USD 539.00

5 Days

Rabbit Polyclonal Anti-SIRT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the middle region of human SIRT6. Synthetic peptide located within the following region: TRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVP
SIRT6 Rabbit Polyclonal Antibody
TA330291

USD 485.00

5 Days

Rabbit Polyclonal Anti-SIRT6 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6. Synthetic peptide located within the following region: STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVG
Sirt6 Rabbit Polyclonal Antibody
TA381514

USD 365.00

3 Weeks

SIRT6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of mouse SIRT6 (NP_001156902.1).
Modifications Unmodified
SIRT6 Rabbit Polyclonal Antibody
TA324068

USD 380.00

In Stock

Anti-SIRT6 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 35-274 amino acids of human sirtuin 6
SIRT6 Rabbit Polyclonal Antibody
TA381513

USD 365.00

3 Weeks

SIRT6 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIRT6.