Antibodies

Jump to Filters
View as table Download
GJA1 Goat Polyclonal Antibody
AB0016-200

USD 355.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.
GJA1 Goat Polyclonal Antibody
AB0016-500

USD 500.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.
N Cadherin (CDH2) Goat Polyclonal Antibody
AB0071-200

USD 330.00

In Stock

Goat Polyclonal Anti-CDH2 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 850 aa to C-terminus of human CDH2 produced in E. coli.
N Cadherin (CDH2) Rabbit Polyclonal Antibody
TA326835

USD 365.00

2 Weeks

N-cadherin Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human N-cadherin
Integrin beta 1 (ITGB1) Rabbit Polyclonal Antibody
TA349358

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ITGB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB1
CD41 (ITGA2B) Rabbit Polyclonal Antibody
TA350095

USD 380.00

In Stock

Rabbit Polyclonal Anti-ITGA2B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ITGA2B
GJA1 Rabbit Polyclonal Antibody
TA311737

USD 380.00

4 Weeks

Rabbit polyclonal Connexin 43 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Connexin 43.
CD61 (ITGB3) Rabbit Polyclonal Antibody
TA349357

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-ITGB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ITGB3
GJA1 Goat Polyclonal Antibody
AB0015-200

USD 355.00

In Stock

Goat Polyclonal Anti-CX43 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli.
alpha Sarcoglycan (SGCA) Rabbit Polyclonal Antibody
TA314526

USD 380.00

2 Weeks

Rabbit polyclonal anti-SGCA antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SGCA.
Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody
TA306659

USD 570.00

2 Weeks

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.
CACNG6 Rabbit Polyclonal Antibody
TA324466

USD 580.00

5 Days

Rabbit polyclonal CACNG6 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6.
Emerin (EMD) Rabbit Polyclonal Antibody
TA306389

USD 570.00

5 Days

Rabbit Polyclonal Emerin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Emerin antibody was raised against a 19 amino acid peptide from near the amino terminus of human Emerin.
CD51 (ITGAV) Rabbit Polyclonal Antibody
TA338302

USD 539.00

5 Days

Rabbit Polyclonal Anti-ITGAV Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG
Desmocollin 2 (DSC2) Rabbit Polyclonal Antibody
TA307897

USD 625.00

5 Days

Rabbit polyclonal antibody to Desmocollin 2 (desmocollin 2)

Applications IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 480 and 706 of Desmocollin 2 (Uniprot ID#Q02487)