Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GABA B Receptor 1 (GABBR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 930-950 of Human GABAB R1. |
PRL Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRL |
Rabbit polyclonal PLMN (heavy chain A short form, Cleaved-Val98) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human PLMN. |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR |
Rabbit Polyclonal Anti-GABBR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABBR1 Antibody: A synthesized peptide derived from human GABBR1 |
Rabbit Polyclonal Anti-THRB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB |
Rabbit anti GABA Receptor 1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-term of human GABA receptor 1 protein. This sequence is identical to human and rat. |
Active filters
Reactivities
- Rat
Applications
- WB
Conjugates
- Unconjugated
Families
- Secreted Protein
Pathways
- Neuroactive ligand-receptor interaction