bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BFGF mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
bFGF (FGF2) mouse monoclonal antibody, clone OTI2H11 (formerly 2H11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BFGF mouse monoclonal antibody, clone OTI2H11 (formerly 2H11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BFGF mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
bFGF (FGF2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-FGF2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
FGF2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide mapping near the N-terminal of Human FGF2, identical to the related Rat and Mouse sequence |
Rabbit polyclonal anti-FGF2 Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGF2 |
Rabbit polyclonal anti-FGF2 Antibody
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGF2 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FGF2 mouse monoclonal antibody, clone F-474, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
bFGF (FGF2) mouse monoclonal antibody, clone OTI2H11 (formerly 2H11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FGF2 mouse monoclonal antibody, clone F-343, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FGF2 mouse monoclonal antibody, clone F-3, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |