Antibodies

View as table Download

HGF mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HGF mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HGF mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HGF mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HGF mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) HGF mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HGF mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

HGF mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HGF mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Carrier-free (BSA/glycerol-free) HGF mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

HGF mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-HGF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

Rabbit Polyclonal Anti-HGF Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG

Rabbit Polyclonal Anti-HGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the middle region of human HGF. Synthetic peptide located within the following region: NENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI