Antibodies

View as table Download

Anti-PANK2 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PANK2 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Anti-PANK2 mouse monoclonal antibody, clone OTI3H9 (formerly 3H9)

Applications FC, IF, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PANK2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PANK2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PANK2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PANK2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PANK2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-PANK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANK2 antibody is: synthetic peptide directed towards the middle region of HUMAN PANK2. Synthetic peptide located within the following region: FGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMCAL

Rabbit Polyclonal Anti-PANK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANK2 antibody is: synthetic peptide directed towards the C-terminal region of Human PANK2. Synthetic peptide located within the following region: FEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEK

PANK2 mouse monoclonal antibody, clone OTI3G4 (formerly 3G4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".