Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Phospho-CDK4-T172 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around T172 of human CDK4 (NP_000066.1). |
| Modifications | Phospho T172 |
Rabbit Polyclonal Anti-CDK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK4 antibody: synthetic peptide directed towards the C terminal of human CDK4. Synthetic peptide located within the following region: PRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
CDK4 rabbit polyclonal antibody, Serum
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | cdk4 (p34) peptide corresponding to the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
CDK4 rabbit polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TrpE-fusion protein containing the C-terminal 164 amino acids of human Cdk4. |
Germany
Japan
United Kingdom
China
