Anti-ACOT2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2 |
Goat Polyclonal Antibody against FADS1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QPSFEPTKNKELTDE, from the internal region of the protein sequence according to NP_037534.2. |
Rabbit Polyclonal Anti-Hsd17b12 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS |
Rabbit Polyclonal Anti-ACOX3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT |
Germany
Japan
United Kingdom
China
