Antibodies

View as table Download

Rabbit Polyclonal Anti-PARP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PARP3

Rabbit Polyclonal Anti-PARP3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PARP3 antibody: synthetic peptide directed towards the C terminal of human PARP3. Synthetic peptide located within the following region: LGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVP

Rabbit polyclonal PARP3 Antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PARP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 99-126 amino acids from the N-terminal region of human PARP3.