Antibodies

Jump to Filters
View as table Download
SMAD5 Rabbit Polyclonal Antibody
TA323512

USD 380.00

In Stock

Anti-SMAD5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 300 amino acids of human SMAD family member 5
SMAD5 Rabbit Polyclonal Antibody
TA329743

USD 539.00

5 Days

Rabbit Polyclonal Anti-SMAD5 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD5 antibody: synthetic peptide directed towards the middle region of human SMAD5. Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
SMAD5 Rabbit Polyclonal Antibody
TA332472

USD 365.00

3 Weeks

Rabbit anti-SMAD5 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human SMAD5
SMAD5 Rabbit Polyclonal Antibody
TA329744

USD 485.00

5 Days

Rabbit Polyclonal Anti-SMAD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD5 antibody: synthetic peptide directed towards the middle region of human SMAD5. Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
SMAD5 Rabbit Polyclonal Antibody
TA362593

USD 539.00

5 Days

SMAD5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human SMAD5