Rabbit polyclonal RARA Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This RARA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-349 amino acids from the C-terminal region of human RARA. |
Rabbit Polyclonal RARA Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RARA antibody: human RARA (Retinoic Acid Receptor alpha) using two KLH-conjugated synthetic peptides containing sequences from the C-terminal region of the protein. |
Rabbit Polyclonal Anti-PPARD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the n terminal of human PPARD. Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS |
Rabbit Polyclonal Anti-PPARD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY |
Rabbit anti-PPARD Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PPARD |
Goat Polyclonal Antibody against PPAR delta (Isoform 1)
| Applications | WB |
| Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CHPLLQEIYKDMY, from the C Terminus of the protein sequence according to NP_006229.1. |
Goat Polyclonal Antibody against RARA
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SPSLSPSSHRSSPATQSP, from the C Terminus of the protein sequence according to NP_000955.1; NP_001019980.1; NP_001028775.1. |
Rabbit polyclonal PPARD Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PPARD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human PPARD. |
Rabbit Polyclonal Anti-PPARD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PPARD Antibody: synthetic peptide directed towards the middle region of human PPARD. Synthetic peptide located within the following region: NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIET |
Rabbit Polyclonal Anti-Phospho-Retinoic Acid Receptor alpha (Ser77) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-Retinoic Acid Receptor alpha (Ser77) Antibody: A synthesized peptide derived from human Retinoic Acid Receptor alpha around the phosphorylation site of Sersine 77 |
| Modifications | Phospho-specific |
Rabbit anti PPARb Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The full-length recombinant protein of human PPAR-beta. |
Germany
Japan
United Kingdom
China
