Antibodies

Jump to Filters
View as table Download
TUBB6 Rabbit Polyclonal Antibody
TA342935

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-TUBB6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBB6 antibody: synthetic peptide directed towards the N terminal of human TUBB6. Synthetic peptide located within the following region: QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIF
TUBB6 (Center) Rabbit Polyclonal Antibody
AP54418PU-N

USD 580.00

2 Weeks

TUBB6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 146-174 amino acids from the Central region of human TUBB6