Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Yeast, Dog, Chicken, Chimpanzee, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174) |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
GND1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | 6-Phosphogluconic dehydrogenase isolated and purified from yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Formate dehydrogenase rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Formate Dehydrogenase is isolated and purified from Yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
GLO1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Glyoxalase isolated and purified from Yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CHK1 (312-327) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding aa 312-327 of S. cerevisiae CHK1 |
HIST4H4 (acetyl K5) rabbit polyclonal antibody, Serum
| Applications | ChIP, ELISA, IF, IP, WB |
| Reactivities | Amphibian, Drosophila, Mammalian, Plant, Yeast |
| Conjugation | Unconjugated |
| Immunogen | Ovalbumin-conjugated peptide. |
Rabbit Polyclonal Anti-Pst1 Antibody
| Applications | WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Pst1 antibody was raised against a synthetic peptide from the amino terminus of yeast Pst1. |
Histone H2B (yeast) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from yeast Histone H2B (yeast) |
RAD9A rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to aa 1125-1139 of yeast Rad9 protein conjugated to Keyhole Limpet Haemocyanin (KLH). |
Germany
Japan
United Kingdom
China
