Antibodies

View as table Download

Rabbit Polyclonal Antibody against ABCF2

Applications ICC/IF, Simple Western, WB
Reactivities Human, Yeast
Conjugation Unconjugated
Immunogen A fusion protein containing amino acids 1-102 of the ABCF2 protein.

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast
Conjugation Unconjugated
Immunogen Recombinant human Caspase-3 protein (full length)