Antibodies

Jump to Filters
View as table Download
UBE2E1 Rabbit Polyclonal Antibody
TA309924

USD 550.00

5 Days

Rabbit Polyclonal UBCH6 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human UBCH6 protein (between residues 1-50) [UniProt P51965]
TRAF6 Rabbit Polyclonal Antibody
TA306124

USD 570.00

5 Days

Rabbit Polyclonal TRAF6 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRAF6 antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human TRAF6.
WWP2 Rabbit Polyclonal Antibody
TA329807

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WWP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WWP2 antibody: synthetic peptide directed towards the middle region of human WWP2. Synthetic peptide located within the following region: SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP
Cullin 4B (CUL4B) Rabbit Polyclonal Antibody
TA324698

USD 580.00

5 Days

Rabbit polyclonal CUL4B Antibody (Center)

Applications WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This CUL4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-278 amino acids from the Central region of human CUL4B.
DET1 Rabbit Polyclonal Antibody
TA330908

USD 539.00

5 Days

Rabbit Polyclonal Anti-DET1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DET1 antibody is: synthetic peptide directed towards the N-terminal region of Human DET1. Synthetic peptide located within the following region: DCRCVIVGSAAYLPDEPHPPFFEVYRNSESVTPNPRSPLEDYSLHIIDLH
MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
TA346746

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAP3K1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
BRCA1 Rabbit Polyclonal Antibody
TA348436

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Phospho-BRCA1(Ser1457) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-BRCA1(Ser1457) Antibody: A synthesized peptide derived from human BRCA1 around the phosphorylation site of Sersine 1457
Modifications Phospho-specific
Cullin 3 (CUL3) Rabbit Polyclonal Antibody
TA326917

USD 365.00

3 Weeks

Rabbit anti-CUL3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL3