Germany
Japan
United Kingdom
China
EGFR mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Antibodies
View as table DownloadRabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against DKK4
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RQHARLRVCQKIEKL, from the C Terminus of the protein sequence according to NP_055235. |
CD34 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
NOTCH1 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a sequence at the middle region of human NOTCH1 |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2 antibody: synthetic peptide directed towards the middle region of human WNT2. Synthetic peptide located within the following region: GSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGKDARALMNLHNNR |
Active filters
Applications
- WB
Conjugates
- Unconjugated
Families
- Cancer stem cells
Citations
- Yes
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Pathways in cancer (12)
- Hedgehog signaling pathway (9)
- Hematopoietic cell lineage (9)
- Basal cell carcinoma (8)
- Dorso-ventral axis formation (7)
- Notch signaling pathway (7)
- Wnt signaling pathway (7)
- ECM-receptor interaction (6)
- Adherens junction (4)
- Colorectal cancer (4)
- Melanogenesis (4)
- Pancreatic cancer (4)
- Prion diseases (4)
- TGF-beta signaling pathway (4)
- Bladder cancer (3)
- Calcium signaling pathway (3)
- Cell adhesion molecules (CAMs) (3)
- Cytokine-cytokine receptor interaction (3)
- Endocytosis (3)
- Endometrial cancer (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- ErbB signaling pathway (3)
- Focal adhesion (3)
- Gap junction (3)
- Glioma (3)
- GnRH signaling pathway (3)
- MAPK signaling pathway (3)
- Melanoma (3)
- Non-small cell lung cancer (3)
- Prostate cancer (3)
- Regulation of actin cytoskeleton (3)
- Maturity onset diabetes of the young (2)
- Cell cycle (1)
- Chronic myeloid leukemia (1)