Antibodies

View as table Download

Rabbit Polyclonal Anti-ERAS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ERAS

Rabbit Polyclonal Anti-Eras Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Eras Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV