Germany
Japan
United Kingdom
China
MARCO (420-431) mouse monoclonal antibody, clone PLK-1, Purified
| Applications | FC, FN, IF, IHC, IP, WB |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MARCO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MARCO antibody: synthetic peptide directed towards the N terminal of human MARCO. Synthetic peptide located within the following region: QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL |
Rabbit Polyclonal Anti-MARCO Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MARCO antibody: synthetic peptide directed towards the C terminal of human MARCO. Synthetic peptide located within the following region: GPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGE |
Recombinant Anti-MARCO (Clone PLK1)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MARCO (Clone PLK1)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MARCO Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MARCO |
