Antibodies

View as table Download

ACTN2 (215-500) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 215 and 500 of actinin, alpha 2

Rabbit polyclonal Actinin alpha-2/3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human Actinin a-2/3.

Sarcomeric alpha Actinin Rabbit monoclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTN2

ACTN2 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ACTN2 (NP_001094.1).
Modifications Unmodified

ACTN2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTN2

Sarcomeric alpha Actinin Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human ACTN2

ACTN2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 750-779 amino acids from the C-terminal region of human ACTN2

Rabbit Polyclonal Anti-ACTN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN

Rabbit Polyclonal Anti-Actinin a 2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Actinin a 2/3 Antibody: A synthesized peptide derived from human Actinin a 2/3