Neurofilament (NEFM) (C-term)) chicken polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Chicken, Feline, Human, Mouse, Rat |
Conjugation | Unconjugated |
Neurofilament (NEFM) (C-term)) chicken polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Chicken, Feline, Human, Mouse, Rat |
Conjugation | Unconjugated |
Neurofilament (NEFM) mouse monoclonal antibody, clone RNF403, Purified
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Monkey, Rat, Xenopus |
Conjugation | Unconjugated |
Neurofilament (NEFM) mouse monoclonal antibody, clone 3H11
Applications | IF, IHC, WB |
Reactivities | Chicken, Feline, Human, Mouse, Rat |
Conjugation | Unconjugated |
Neurofilament M Rabbit polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Neurofilament M (NP_005373.2). |
Modifications | Unmodified |
NEFM rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NEFM |
Neurofilament (NEFM) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QASHITVERKDYLK, from the internal region of the protein sequence |
Chicken Anti-Neurofilament NF-M ck Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Preparation containing the extreme C-terminus expressed in and purified from E. Coli |
Mouse Anti-Neurofilament NF-M ms Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Nefm Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Nefm antibody is: synthetic peptide directed towards the C-terminal region of Rat Nefm. Synthetic peptide located within the following region: GGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVKEVTQ |
Neurofilament (NEFM) mouse monoclonal antibody, clone NF403, Supernatant
Applications | IHC, WB |
Reactivities | Bovine, Guinea Pig, Human, Rat |
Conjugation | Unconjugated |