Antibodies

Jump to Filters
View as table Download
PRUNE (PRUNE1) Rabbit Polyclonal Antibody
TA344725

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-PRUNE Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PRUNE antibody is: synthetic peptide directed towards the C-terminal region of Human PRUNE. Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS
PRUNE (PRUNE1) (C-term) Rabbit Polyclonal Antibody
AP53474PU-N

USD 580.00

2 Weeks

PRUNE (PRUNE1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 367-397aa) of human PRUNE
PRUNE (PRUNE1) Mouse Monoclonal Antibody [Clone ID: 1C11]
AM31933PU-N

USD 565.00

2 Weeks

PRUNE (PRUNE1) mouse monoclonal antibody, clone 1C11, Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
PRUNE (PRUNE1) Rabbit Polyclonal Antibody
TA361174

USD 539.00

5 Days

PRUNE1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRUNE