Germany
Japan
United Kingdom
China
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rat monoclonal anti-TUBA1A(alpha Tubulin ) antibody, clone YL1/2, Loading control
| Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mammalian, Mouse, Rat, Yeast |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TUBA4A Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
-(5).tif?d=110x100 "User supplied image.<br /><br /><em>Ana C. for TA345670 on 06/02/2023:</em><br />IF staining of MDA-MB-231cells. F-actin staining in red, nuclei in blue and alpha-tubulin in red.<br />Antibody Dilution: 1: 500<br />Secondary Antibody: Goat anti-rabbit Alexa-Fluor 488<br />Secondary Antibody: dilution: 1: 1000. F-actin staining with Alexa Fluor 594 Phalloidin 1:40<br />Color/Signal Descriptions: TUBA4A: green<br />F-actin: red DAPI: Blue<br />Gene Name: TUBA4A")
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 227 and 440 of alpha Tubulin 1A (Uniprot ID#Q71U36) |
TUBA1A mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-TUBA3C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL |
Active filters
Category
- Antibodies
Target Symbol
- ALPHA TUBULIN
Reactivities
- Human
Applications
- WB
Pathways
- Pathogenic Escherichia coli infection