Antibodies

Jump to Filters
View as table Download
HS3ST1 Rabbit Polyclonal Antibody
TA332073

USD 539.00

In Stock

Rabbit Polyclonal Anti-HS3ST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HS3ST1 Antibody: synthetic peptide directed towards the middle region of human HS3ST1. Synthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
HS3ST1 Goat Polyclonal Antibody
TA329076

USD 520.00

5 Days

HS3ST1 Goat Polyclonal Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen C Terminus (NKLHEYFHEPNKK)