PNPLA3 Rabbit monoclonal antibody,clone OTIR1D10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PNPLA3 Rabbit monoclonal antibody,clone OTIR1D10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PNPLA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS |
Goat Polyclonal Antibody against PNPLA3
Applications | IHC, PEP-ELISA, WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence EHDICPKVKSTN, from the internal region of the protein sequence according to NP_473429.2. |
Rabbit Polyclonal Anti-GPD2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GPD2 |
Rabbit Polyclonal GPAT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPAT1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of the human GPAT1. The immunogen is located within amino acids 730 - 780 of GPAT1. |
Anti-AGPAT2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 244-278 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 2 |
Rabbit Polyclonal Anti-ACHE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACHE |
Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 406 and 614 of AChE (Uniprot ID#P22303) |
Anti-PPAP2A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Rabbit polyclonal ACHE Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACHE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-175 amino acids from the N-terminal region of human ACHE. |
Rabbit polyclonal LCAT Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LCAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of human LCAT. |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit polyclonal PCYT1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Hamster) |
Conjugation | Unconjugated |
Immunogen | This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A. |
Rabbit Polyclonal Anti-LCAT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LCAT antibody: synthetic peptide directed towards the C terminal of human LCAT. Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL |
Goat Polyclonal Antibody against ACHE
Applications | FC, IF, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QFDHYSKQDRCSDL, from the C Terminus of the protein sequence according to NP_000656.1. |