Antibodies

View as table Download

PNPLA3 Rabbit monoclonal antibody,clone OTIR1D10

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-PNPLA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS

Goat Polyclonal Antibody against PNPLA3

Applications IHC, PEP-ELISA, WB
Reactivities Human, Mouse (Expected from sequence similarity: Rat, Dog, Pig)
Conjugation Unconjugated
Immunogen Peptide with sequence EHDICPKVKSTN, from the internal region of the protein sequence according to NP_473429.2.

Rabbit Polyclonal Anti-GPD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPD2

Rabbit Polyclonal GPAT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GPAT1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of the human GPAT1. The immunogen is located within amino acids 730 - 780 of GPAT1.

Anti-AGPAT2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 244-278 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 2

Rabbit Polyclonal Anti-ACHE Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACHE

Rabbit polyclonal antibody to AChE (acetylcholinesterase (Yt blood group))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 406 and 614 of AChE (Uniprot ID#P22303)

Anti-PPAP2A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A

Rabbit polyclonal ACHE Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACHE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 147-175 amino acids from the N-terminal region of human ACHE.

Rabbit polyclonal LCAT Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LCAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of human LCAT.

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)

Rabbit polyclonal PCYT1A Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Hamster)
Conjugation Unconjugated
Immunogen This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A.

Rabbit Polyclonal Anti-LCAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCAT antibody: synthetic peptide directed towards the C terminal of human LCAT. Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL

Goat Polyclonal Antibody against ACHE

Applications FC, IF, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence QFDHYSKQDRCSDL, from the C Terminus of the protein sequence according to NP_000656.1.