Antibodies

Jump to Filters
View as table Download
TAS1R1 (Center) Rabbit Polyclonal Antibody
AP54153PU-N

USD 580.00

2 Weeks

TAS1R1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 322-351 amino acids from the Central region of human TAS1R1
TAS1R1 Rabbit Polyclonal Antibody
TA337751

USD 539.00

5 Days

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT
TAS1R1 Rabbit Polyclonal Antibody
TA337910

USD 539.00

5 Days

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the middle region of Human TAS1R1. Synthetic peptide located within the following region: QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP