TAS1R1 Rabbit Polyclonal Antibody

CAT#: TA337751

Rabbit Polyclonal Anti-TAS1R1 Antibody

Product Images

Host: Rabbit; Target Name: TAS1R1; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: taste 1 receptor member 1
• Database Link:
  NP_803884
  Entrez Gene 80835 Human
  UniProt ID Q7RTX1
• Background: The protein encoded by this gene is a G protein-coupled receptor and is a component of the heterodimeric amino acid taste receptor T1R1+3. The T1R1+3 receptor responds to L-amino acids but not to D-enantiomers or other compounds. Most amino acids that are perceived as sweet activate T1R1+3, and this activation is strictly dependent on an intact T1R1+3 heterodimer. Multiple transcript variants encoding different isoforms have been found for this gene.
• Synonyms: GM148; GPR70; T1R1; TR1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Rat: 91%; Dog: 86%; Bovine: 85%; Mouse: 83%; Rabbit: 83%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Taste transduction