TTK mouse monoclonal antibody,clone OTI13E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TTK mouse monoclonal antibody,clone OTI13E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TTK mouse monoclonal antibody,clone OTI1D4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TTK mouse monoclonal antibody,clone OTI1D4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TTK mouse monoclonal antibody,clone OTI13E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal TTK (Ab-676) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
USD 509.00
2 Weeks
TTK mouse monoclonal antibody,clone OTI1D4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
TTK mouse monoclonal antibody,clone OTI1D4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
TTK mouse monoclonal antibody,clone OTI13E9, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
TTK mouse monoclonal antibody,clone OTI13E9, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit anti-TTK Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TTK |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MAP3K1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
Rabbit Polyclonal Anti-TTK Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TTK Antibody: A synthesized peptide derived from human TTK |
TTK mouse monoclonal antibody,clone OTI1D4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TTK mouse monoclonal antibody,clone OTI13E9
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".