Antibodies

View as table Download

Anti-F7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human coagulation factor VII (serum prothrombin conversion accelerator)

Rabbit polyclonal antibody to Factor VII (coagulation factor VII (serum prothrombin conversion accelerator))

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 209 and 466 of Factor VII (Uniprot ID#P08709)

Rabbit polyclonal FA7 (light chain, Cleaved-Arg212) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human FA7.

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AD-1, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin

Rabbit Polyclonal Anti-F7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F7 antibody: synthetic peptide directed towards the C terminal of human F7. Synthetic peptide located within the following region: AAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTN

Rabbit Polyclonal Anti-F7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F7 antibody: synthetic peptide directed towards the middle region of human F7. Synthetic peptide located within the following region: RCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG

Factor VII (F7) mouse monoclonal antibody, clone RFFVII/2, Aff - Purified

Applications ELISA, R, WB
Reactivities Human
Conjugation Unconjugated

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone CaFVII-22, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone CaFVII-22, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AA-3, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin

Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AD-1, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated