Antibodies

View as table Download

Rabbit polyclonal anti-MMP-7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-7.

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.

Rabbit Polyclonal antibody to SENP2 (SUMO1/sentrin/SMT3 specific peptidase 2)

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 62 of SENP2 (Uniprot ID#Q9HC62)

Rabbit polyclonal Presenilin 1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human presenilin 1.

Goat Polyclonal Antibody against MMP7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKLYGKRSNSRKK, from the C Terminus of the protein sequence according to NP_002414.1.

Rabbit anti-MMP7 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MMP7

Rabbit polyclonal anti-SENP2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human SENP2.

Anti-MMP7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 5-100 amino acids of human matrix metallopeptidase 7 (matrilysin, uterine)

Rabbit Polyclonal Anti-MMP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP7 antibody: synthetic peptide directed towards the C terminal of human MMP7. Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK

Rabbit Polyclonal Anti-PSEN1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY

Rabbit Polyclonal Anti-MMP7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP7 Antibody: A synthesized peptide derived from human MMP7

Rabbit Polyclonal Anti-Presenilin 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1

Rabbit anti MMP-7 (Matrilysin) Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human MMP-7. This sequence is identical among bovine and monkey.