Rabbit polyclonal anti-MMP-7 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-7. |
Rabbit polyclonal anti-MMP-7 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-7. |
Rabbit Polyclonal Presenilin1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1. |
Rabbit Polyclonal antibody to SENP2 (SUMO1/sentrin/SMT3 specific peptidase 2)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 62 of SENP2 (Uniprot ID#Q9HC62) |
Rabbit polyclonal Presenilin 1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human presenilin 1. |
Goat Polyclonal Antibody against MMP7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QKLYGKRSNSRKK, from the C Terminus of the protein sequence according to NP_002414.1. |
Rabbit anti-MMP7 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MMP7 |
Rabbit polyclonal anti-SENP2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human SENP2. |
Anti-MMP7 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 5-100 amino acids of human matrix metallopeptidase 7 (matrilysin, uterine) |
Rabbit Polyclonal Anti-MMP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP7 antibody: synthetic peptide directed towards the C terminal of human MMP7. Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK |
Rabbit Polyclonal Anti-PSEN1 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY |
Rabbit Polyclonal Anti-MMP7 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP7 Antibody: A synthesized peptide derived from human MMP7 |
Rabbit Polyclonal Anti-Presenilin 1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1 |
Rabbit anti MMP-7 (Matrilysin) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of human MMP-7. This sequence is identical among bovine and monkey. |