Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL |
Anti-APG4B Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 5-20 amino acids of Human Autophagy-related protein 4 homolog B |
ATG4A Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATG4A |
Rabbit Polyclonal anti-ATG4A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the N terminal of human ATG4A. Synthetic peptide located within the following region: DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR |
Rabbit Polyclonal anti-ATG4A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4A antibody: synthetic peptide directed towards the middle region of human ATG4A. Synthetic peptide located within the following region: PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTF |
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG4B Antibody: synthetic peptide directed towards the C terminal of human ATG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL |
Rabbit Polyclonal Anti-ATG4C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4C antibody: synthetic peptide directed towards the middle region of human ATG4C. Synthetic peptide located within the following region: TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS |
Rabbit Polyclonal Anti-ATG4B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4B antibody: synthetic peptide directed towards the N terminal of human ATG4B. Synthetic peptide located within the following region: WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS |
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4B Antibody: A synthesized peptide derived from human ATG4B |
Active filters
Category
- Antibodies
Applications
- WB
Isotypes
- IgG
Families
- Protease
Pathways
- Regulation of autophagy