Antibodies

Jump to Filters
View as table Download
PPAR delta (PPARD) Mouse Monoclonal Antibody [Clone ID: OTI4D10]
CF811238

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PPARD mouse monoclonal antibody,clone OTI4D10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPAR delta (PPARD) Mouse Monoclonal Antibody [Clone ID: OTI2D2]
CF811236

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PPARD mouse monoclonal antibody,clone OTI2D2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PPAR delta (PPARD) Mouse Monoclonal Antibody [Clone ID: OTI4D10]
TA811238S

USD 200.00

In Stock

PPARD mouse monoclonal antibody,clone OTI4D10

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPAR delta (PPARD) (430-441) Goat Polyclonal Antibody
AP23032PU-N

USD 500.00

2 Weeks

PPAR delta (PPARD) (430-441) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide from the C-terminus of human PPARD
PPAR delta (PPARD) (C-term) Rabbit Polyclonal Antibody
AP53408PU-N

USD 580.00

2 Weeks

PPAR delta (PPARD) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 374-402 amino acids from the C-terminal region of human PPAR-delta
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA343593

USD 539.00

5 Days

Rabbit Polyclonal Anti-PPARD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARD antibody: synthetic peptide directed towards the n terminal of human PPARD. Synthetic peptide located within the following region: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSS
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA343594

USD 485.00

5 Days

Rabbit Polyclonal Anti-PPARD Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPARD antibody: synthetic peptide directed towards the C terminal of human PPARD. Synthetic peptide located within the following region: AQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
PPAR delta (PPARD) Rabbit Polyclonal Antibody
TA332820

USD 365.00

3 Weeks

Rabbit anti-PPARD Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPARD