ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7), Biotinylated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Biotin |
ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | HRP |
ZIC3 mouse monoclonal antibody, clone OTI6F7 (formerly 6F7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ZIC3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ZIC3 Antibody: synthetic peptide directed towards the N terminal of human ZIC3. Synthetic peptide located within the following region: HHHHHTSQVPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLFAG |
ZIC3 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".