Rabbit polyclonal HNF1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Rabbit polyclonal HNF1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Rabbit polyclonal HNF1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B. |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-HNF1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HNF1B Antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: NFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYD |
Goat Polyclonal Antibody against TCF2 / VHNF1
Applications | ICC, PEP-ELISA, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow, Zebrafish) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1. |
Anti-HNF1B Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human HNF1 homeobox B |
Rabbit Polyclonal Anti-HNF1B Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL |
Rabbit Polyclonal Anti-HNF1B Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the N terminal of human HNF1B. Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL |
Rabbit Polyclonal Anti-HNF1B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the C terminal of human HNF1B. Synthetic peptide located within the following region: QGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMIS |
Rabbit Polyclonal Anti-HNF-1β(TCF-2) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF-1β(TCF-2) Antibody: Peptide sequence around aa.252~256(R-Q-K-N-P) derived from Human HNF-1b(TCF-2). |