Antibodies

Jump to Filters
View as table Download
CACNG1 Rabbit Polyclonal Antibody
TA338366

USD 539.00

5 Days

Rabbit Polyclonal Anti-Cacng1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIIGSICAFL
CACNG1 Rabbit Polyclonal Antibody
TA313541

USD 380.00

4 Weeks

Rabbit polyclonal anti-CACNG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CACNG1.