GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey |
Conjugation | Unconjugated |
GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey |
Conjugation | Unconjugated |
GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GLB1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
Applications | IHC, WB |
Reactivities | Human, Dog, Monkey |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201) |
Rabbit Polyclonal Anti-SLC33A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC33A1 Antibody: synthetic peptide directed towards the middle region of human SLC33A1. Synthetic peptide located within the following region: CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG |
GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)
Applications | IHC, WB |
Reactivities | Human (Predicted: Dog, Feline) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278) |