Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA |
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE |
Rabbit anti-SOD1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SOD1 |
Rabbit Polyclonal Anti-SOD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1 |
Germany
Japan
United Kingdom
China
