Antibodies

View as table Download

MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 mouse monoclonal antibody,clone OTI2E3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody,clone OTI2E3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAP3K8 mouse monoclonal antibody,clone OTI2E3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MAP3K8 mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal COT (Ab-290) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human COT around the phosphorylation site of threonine 290 (R-G-TP-E-I).

Rabbit polyclonal MAP3K8 (Ab-400) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MAP3K8 around the phosphorylation site of serine 400 (C-Q-SP-L-D).

MAP3K8 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-300 of Human Cot.

Rabbit Polyclonal COT Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human COT

Rabbit Polyclonal COT (Thr290) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human COT around the phosphorylation site of Threonine 290
Modifications Phospho-specific

Rabbit Polyclonal anti-MAP3K8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the C terminal of human MAP3K8. Synthetic peptide located within the following region: PRCQSLDSALLERKRLLSRKELELPENIADSSCTGSTEESEMLKRQRSLY

Rabbit Polyclonal anti-MAP3K8 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K8 antibody: synthetic peptide directed towards the N terminal of human MAP3K8. Synthetic peptide located within the following region: ASEEPAVYEPSLMTMCQDSNQNDERSKSLLLSGQEVPWLSSVRYGTVEDL