Antibodies

Jump to Filters
View as table Download
IHH Rabbit Polyclonal Antibody
TA356477

USD 485.00

5 Days

IHH Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human IHH
DHH Rabbit Polyclonal Antibody
TA308606

USD 625.00

In Stock

Rabbit polyclonal antibody to Dhh (desert hedgehog homolog (Drosophila))

Applications WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 135 and 396 of Dhh (Uniprot ID#O43323)
IHH (N-term) Rabbit Polyclonal Antibody
AP52178PU-N

USD 580.00

2 Weeks

IHH (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 50-80aa) of human Indian hedgehog protein / IHH.
DHH Rabbit Polyclonal Antibody
TA343152

USD 539.00

5 Days

Rabbit Polyclonal Anti-DHH Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Dhh antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dhh. Synthetic peptide located within the following region: FRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRL