MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Acid Phosphatase (ACP1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 33~61 amino acids from the N-terminal region of human ACP1 |
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IHC, IP, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
USD 490.00
2 Weeks
Prostatic Acid Phosphatase (ACPP) mouse monoclonal antibody, clone LT-3D1, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Prostatic Acid Phosphatase (ACPP) (269-282) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001127666.1, NP_001090.2. |
Rabbit Polyclonal Anti-ACP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
Anti-ACPP Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate |
Anti-ACPP Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate |