Antibodies

View as table Download

MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI1H8 (formerly 1H8)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MTMR2 mouse monoclonal antibody, clone OTI1F10 (formerly 1F10)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Acid Phosphatase (ACP1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 33~61 amino acids from the N-terminal region of human ACP1

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IHC, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Prostatic Acid Phosphatase (ACPP) (269-282) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_001127666.1, NP_001090.2.

Rabbit Polyclonal Anti-ACP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP

Anti-ACPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate

Anti-ACPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-389 amino acids of human acid phosphatase, prostate