Antibodies

Jump to Filters
View as table Download
ACSS1 Rabbit Polyclonal Antibody
TA373217

USD 365.00

3 Weeks

ACSS1 Rabbit polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 340-689 of human ACSS1 (NP_115890.2).
Modifications Unmodified
ACSS1 Rabbit Polyclonal Antibody
TA342879

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACSS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSS1 antibody is: synthetic peptide directed towards the middle region of Human ACSS1. Synthetic peptide located within the following region: QHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTS