ACSS1 Rabbit Polyclonal Antibody

CAT#: TA342879

Rabbit Polyclonal Anti-ACSS1 Antibody

Product Images

Host: Rabbit; Target Name: ACSS1; Sample Tissue: HCT15 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACSS1 antibody is: synthetic peptide directed towards the middle region of Human ACSS1. Synthetic peptide located within the following region: QHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: acyl-CoA synthetase short-chain family member 1
• Database Link:
  NP_115890
  Entrez Gene 84532 Human
  UniProt ID Q9NUB1
• Background: This gene encodes a mitochondrial acetyl-CoA synthetase enzyme. A similar protein in mice plays an important role in the tricarboxylic acid cycle by catalyzing the conversion of acetate to acetyl CoA. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: ACAS2L; ACECS1; AceCS2L
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Sheep: 93%; Bovine: 93%; Mouse: 86%; Rabbit: 85%; Rat: 79%; Guinea pig: 79%

Reference Data

• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism