Antibodies

Jump to Filters
View as table Download
TWEAK (TNFSF12) Rabbit Polyclonal Antibody
TA306313

USD 570.00

2 Weeks

Rabbit Polyclonal TWEAK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TWEAK antibody was raised against recombinant human TWEAK protein.
TWEAK (TNFSF12) Rabbit Polyclonal Antibody
TA314806

USD 380.00

In Stock

Rabbit polyclonal anti-TNF12 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNF12.
TNFSF12-TNFSF13 Rabbit Polyclonal Antibody
AP20513PU-N

USD 465.00

3 Weeks

TNFSF12-TNFSF13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 51-100 of Human TWEAK.
TWEAK (TNFSF12) Rabbit Polyclonal Antibody
TA330020

USD 539.00

5 Days

Rabbit Polyclonal Anti-TNFSF12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: QEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRA
TWEAK (TNFSF12) Rabbit Polyclonal Antibody
TA341640

USD 539.00

5 Days

Rabbit Polyclonal Anti-TNFSF12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF12 antibody: synthetic peptide directed towards the N terminal of human TNFSF12. Synthetic peptide located within the following region: LGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPF