Antibodies

View as table Download

Anti-IL18RAP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein

Anti-IL18RAP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 378-599 amino acids of human interleukin 18 receptor accessory protein

IL18R Beta (IL18RAP) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human IL18RAP

Rabbit Polyclonal IL-18 R beta/IL-1 R7/ACPL Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a region within amino acids 50-150 of human IL-18 Receptor accessory protein/IL-18 RA/AcPL was used immunogen.

Rabbit Polyclonal Anti-IL18RAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL18RAP antibody: synthetic peptide directed towards the N terminal of human IL18RAP. Synthetic peptide located within the following region: NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC